CTH Antikörper

Produktnummer ABIN629826

Der Kaninchen Polyklonal anti-CTH Antikörper (ABIN629826) detektiert spezifisch CTH in WB und IHC. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für CTH Antikörper (ABIN629826)

Target: CTH (Cystathionase (Cystathionine gamma-Lyase) (CTH))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CTH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-CTH Antikörper

Aufreinigung: Purified

Immunogen: Cystathionase antibody was raised using a synthetic peptide corresponding to a region with amino acids ESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLK

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Cystathionase Blocking Peptide, (ABIN938123), is also available for use as a blocking control in assays to test for specificity of this Cystathionase antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CTH

Target: CTH (Cystathionase (Cystathionine gamma-Lyase) (CTH))

Hintergrund: CTH is a cytoplasmic enzyme in the trans-sulfuration pathway that converts cystathione derived from methionine into cysteine. Glutathione synthesis in the liver is dependent upon the availability of cysteine. Mutations in its gene cause cystathioninuria.

Molekulargewicht: 44 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling, Warburg Effekt