FBP1 Antikörper (N-Term)

Produktnummer ABIN629795

Der Kaninchen Polyklonal Anti-FBP1-Antikörper wurde für WB und IHC validiert. Er ist geeignet, FBP1 in Proben von Human und Maus zu detektieren.

Kurzübersicht für FBP1 Antikörper (N-Term) (ABIN629795)

Target: FBP1 (Fructose-1,6-Bisphosphatase 1 (FBP1))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FBP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-FBP1 Antikörper

Bindungsspezifität: N-Term

Spezifität: FBP1 antibody was raised against the N terminal of FBP1

Aufreinigung: Purified

Immunogen: FBP1 antibody was raised using the N terminal of FBP1 corresponding to a region with amino acids YVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAA

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FBP1 Blocking Peptide, (ABIN936269), is also available for use as a blocking control in assays to test for specificity of this FBP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FBP1

Target: FBP1 (Fructose-1,6-Bisphosphatase 1 (FBP1))

Andere Bezeichnung: FBP1

Hintergrund: Fructose-1,6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1,6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis.Fructose-1,6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1,6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis.

Molekulargewicht: 37 kDa (MW of target protein)

Pathways: Cellular Glucan Metabolic Process, Regulation of Carbohydrate Metabolic Process, Dicarboxylic Acid Transport