BHMT Antikörper (N-Term)

Produktnummer ABIN629793

Dieses Anti-BHMT-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von BHMT in WB und IHC. Geeignet für Human, Maus, Ratte und Hund.

Kurzübersicht für BHMT Antikörper (N-Term) (ABIN629793)

Target: BHMT (Betaine--Homocysteine S-Methyltransferase (BHMT))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BHMT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-BHMT Antikörper

Bindungsspezifität: N-Term

Spezifität: BHMT antibody was raised against the N terminal of BHMT

Aufreinigung: Purified

Immunogen: BHMT antibody was raised using the N terminal of BHMT corresponding to a region with amino acids AVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQE

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BHMT Blocking Peptide, (ABIN936975), is also available for use as a blocking control in assays to test for specificity of this BHMT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BHMT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BHMT

Target: BHMT (Betaine--Homocysteine S-Methyltransferase (BHMT))

Andere Bezeichnung: BHMT

Hintergrund: BHMT is a cytosolic enzyme that catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. Defects in its gene could lead to hyperhomocyst(e)inemia, but such a defect has not yet been observed.Betaine-homocysteine methyltransferase is a cytosolic enzyme that catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. Defects in BHMT could lead to hyperhomocyst(e)inemia,but such a defect has not yet been observed.

Molekulargewicht: 45 kDa (MW of target protein)

Pathways: Methionine Biosynthetic Process