CES1 Antikörper

Produktnummer ABIN629786

Der Kaninchen Polyklonal Anti-CES1-Antikörper wurde für WB validiert. Er ist geeignet, CES1 in Proben von Human zu detektieren.

Kurzübersicht für CES1 Antikörper (ABIN629786)

Target: CES1 (Carboxylesterase 1 (CES1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CES1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CES1 Antikörper

Aufreinigung: Purified

Immunogen: Carboxylesterase 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTPPQPAEPWSFVKNATS

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Carboxylesterase 1 Blocking Peptide, (ABIN5612610), is also available for use as a blocking control in assays to test for specificity of this Carboxylesterase 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CES1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CES1

Target: CES1 (Carboxylesterase 1 (CES1))

Andere Bezeichnung: Carboxylesterase 1

Hintergrund: CES1 is one of the enzymes responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. This enzyme is known to hydrolyze aromatic and aliphatic esters and is necessary for cellular cholesterol esterification.

Molekulargewicht: 61 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process