MKRN1 Antikörper (N-Term)

Produktnummer ABIN629785

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch MKRN1 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus, Hund und Ratte.

Kurzübersicht für MKRN1 Antikörper (N-Term) (ABIN629785)

Target: MKRN1 (Makorin Ring Finger Protein 1 (MKRN1))

Reaktivität: Human, Maus, Hund, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MKRN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MKRN1 Antikörper

Bindungsspezifität: N-Term

Spezifität: MKRN1 antibody was raised against the N terminal of MKRN1

Aufreinigung: Purified

Immunogen: MKRN1 antibody was raised using the N terminal of MKRN1 corresponding to a region with amino acids GDRCRYEHSKPLKQEEATATELTTKSSLAASSSLSSIVGPLVEMNTGEAE

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MKRN1 Blocking Peptide, (ABIN938593), is also available for use as a blocking control in assays to test for specificity of this MKRN1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MKRN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MKRN1

Target: MKRN1 (Makorin Ring Finger Protein 1 (MKRN1))

Andere Bezeichnung: MKRN1

Hintergrund: The Makorin ring finger protein-1 gene (MKRN1) is a highly transcribed, intron-containing source for a family of intronless mammalian genes encoding a novel class of zinc finger proteins. Phylogenetic analyses indicate that the MKRN1 gene is the ancestral founder of this gene family.

Molekulargewicht: 16 kDa (MW of target protein)

Pathways: Chromatin Binding