PGK1 Antikörper (C-Term)

Produktnummer ABIN629772

Dieses Anti-PGK1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von PGK1 in WB und IHC. Geeignet für Human.

Kurzübersicht für PGK1 Antikörper (C-Term) (ABIN629772)

Target: PGK1 (Phosphoglycerate Kinase 1 (PGK1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PGK1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-PGK1 Antikörper

Bindungsspezifität: C-Term

Spezifität: PGK1 antibody was raised against the C terminal of PGK1

Aufreinigung: Purified

Immunogen: PGK1 antibody was raised using the C terminal of PGK1 corresponding to a region with amino acids ATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFAR

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PGK1 Blocking Peptide, (ABIN936960), is also available for use as a blocking control in assays to test for specificity of this PGK1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGK1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PGK1

Target: PGK1 (Phosphoglycerate Kinase 1 (PGK1))

Andere Bezeichnung: PGK1

Hintergrund: PGK1 is a glycolytic enzyme that catalyzes the conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate. The protein may also act as a cofactor for polymerase alpha.

Molekulargewicht: 44 kDa (MW of target protein)

Pathways: Cellular Glucan Metabolic Process