MAT1A Antikörper (N-Term)

Produktnummer ABIN629745

Produktdetails anti-MAT1A Antikörper

Target: MAT1A (Methionine Adenosyltransferase I, alpha (MAT1A))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund, Drosophila melanogaster, C. elegans

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAT1A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: MAT1 A antibody was raised against the N terminal of MAT1

Aufreinigung: Purified

Immunogen: MAT1 A antibody was raised using the N terminal of MAT1 corresponding to a region with amino acids TSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAT1A Blocking Peptide, catalog no. 33R-9282, is also available for use as a blocking control in assays to test for specificity of this MAT1A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAT0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAT1A

Target: MAT1A (Methionine Adenosyltransferase I, alpha (MAT1A))

Andere Bezeichnung: MAT1A (MAT1A Produkte)

Synonyme: MAT antikoerper, MATA1 antikoerper, SAMS antikoerper, SAMS1 antikoerper, AdoMet antikoerper, SADE antikoerper, SAS antikoerper, AI046368 antikoerper, Ams antikoerper, wu:fi35e01 antikoerper, zgc:55442 antikoerper, methionine adenosyltransferase 1A antikoerper, methionine adenosyltransferase I, alpha antikoerper, MAT1A antikoerper, Mat1a antikoerper, mat1a antikoerper

Hintergrund: MAT1A catalyzes the formation of S-adenosylmethionine from methionine and ATP. Methionine adenosyltransferase deficiency is caused by recessive and dominant mutations, the latter identified in autosomal dominant persistant hypermethioninemia.

Molekulargewicht: 43 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, M Phase, Ribonucleoside Biosynthetic Process, Methionine Biosynthetic Process