MAT1A Antikörper (N-Term)

Produktnummer ABIN629745

Der Kaninchen Polyklonal anti-MAT1A Antikörper (ABIN629745) detektiert spezifisch MAT1A in WB und IHC. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus, Ratte, Hund, Drosophila melanogaster und C. elegans.

Kurzübersicht für MAT1A Antikörper (N-Term) (ABIN629745)

Target: MAT1A (Methionine Adenosyltransferase I, alpha (MAT1A))

Reaktivität: Human, Maus, Ratte, Hund, Drosophila melanogaster, C. elegans

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAT1A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-MAT1A Antikörper

Bindungsspezifität: N-Term

Spezifität: MAT1 A antibody was raised against the N terminal of MAT1

Aufreinigung: Purified

Immunogen: MAT1 A antibody was raised using the N terminal of MAT1 corresponding to a region with amino acids TSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAT1A Blocking Peptide, (ABIN5614678), is also available for use as a blocking control in assays to test for specificity of this MAT1A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAT0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAT1A

Target: MAT1A (Methionine Adenosyltransferase I, alpha (MAT1A))

Andere Bezeichnung: MAT1A

Hintergrund: MAT1A catalyzes the formation of S-adenosylmethionine from methionine and ATP. Methionine adenosyltransferase deficiency is caused by recessive and dominant mutations, the latter identified in autosomal dominant persistant hypermethioninemia.

Molekulargewicht: 43 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, M Phase, Ribonucleoside Biosynthetic Process, Methionine Biosynthetic Process