UBE2I Antikörper

Produktnummer ABIN629732

Der Kaninchen Polyklonal Anti-UBE2I-Antikörper wurde für WB validiert. Er ist geeignet, UBE2I in Proben von Human, Maus, Ratte, Zebrafisch (Danio rerio) und Hund zu detektieren.

Kurzübersicht für UBE2I Antikörper (ABIN629732)

Target: UBE2I (Ubiquitin-Conjugating Enzyme E2I (UBE2I))

Reaktivität: Human, Maus, Ratte, Zebrafisch (Danio rerio), Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UBE2I Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-UBE2I Antikörper

Aufreinigung: Purified

Immunogen: UBE2 I antibody was raised using a synthetic peptide corresponding to a region with amino acids MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKG

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UBE2I Blocking Peptide, (ABIN5616868), is also available for use as a blocking control in assays to test for specificity of this UBE2I antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UBE2I

Target: UBE2I (Ubiquitin-Conjugating Enzyme E2I (UBE2I))

Andere Bezeichnung: UBE2I

Hintergrund: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2I is a member of the E2 ubiquitin-conjugating enzyme family.

Molekulargewicht: 17 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Ubiquitin Proteasome Pathway