UBE2D1 Antikörper

Produktnummer ABIN629731

Produktdetails anti-UBE2D1 Antikörper

Target: UBE2D1 (Ubiquitin-Conjugating Enzyme E2D 1 (UBE2D1))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UBE2D1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: UBE2 D1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHARE

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UBE2D1 Blocking Peptide, catalog no. 33R-8734, is also available for use as a blocking control in assays to test for specificity of this UBE2D1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UBE2D1

Target: UBE2D1 (Ubiquitin-Conjugating Enzyme E2D 1 (UBE2D1))

Andere Bezeichnung: UBE2D1 (UBE2D1 Produkte)

Synonyme: E2(17)KB1 antikoerper, SFT antikoerper, UBC4/5 antikoerper, UBCH5 antikoerper, UBCH5A antikoerper, ube2d1 antikoerper, wu:fc16h06 antikoerper, zgc:73096 antikoerper, e2(17)kb1 antikoerper, sft antikoerper, ubc4/5 antikoerper, ubch5 antikoerper, ubch5a antikoerper, ubiquitin conjugating enzyme E2 D1 antikoerper, ubiquitin-conjugating enzyme E2D 1 antikoerper, ubiquitin-conjugating enzyme E2D 1b antikoerper, ubiquitin conjugating enzyme E2 D1 S homeolog antikoerper, UBE2D1 antikoerper, Ube2d1 antikoerper, ube2d1b antikoerper, ube2d1.S antikoerper, ube2d1 antikoerper

Hintergrund: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2D1 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is closely related to a stimulator of iron transport (SFT), and is up-regulated in hereditary hemochromatosis. It also functions in the ubiquitination of the tumor-suppressor protein p53 and the hypoxia-inducible transcription factor HIF1alpha by interacting with the E1 ubiquitin-activating enzyme and the E3 ubiquitin-protein ligases.

Molekulargewicht: 16 kDa (MW of target protein)

Pathways: Activation of Innate immune Response, Toll-Like Receptors Cascades