CDC23 Antikörper

Produktnummer ABIN629729

Der Kaninchen Polyklonal Anti-CDC23-Antikörper wurde für WB validiert. Er ist geeignet, CDC23 in Proben von Human, Maus, Ratte und Hund zu detektieren.

Kurzübersicht für CDC23 Antikörper (ABIN629729)

Target: CDC23 (Cell Division Cycle 23 (CDC23))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CDC23 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CDC23 Antikörper

Aufreinigung: Purified

Immunogen: CDC23 antibody was raised using a synthetic peptide corresponding to a region with amino acids RAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEA

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CDC23 Blocking Peptide, (ABIN5612770), is also available for use as a blocking control in assays to test for specificity of this CDC23 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDC23 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CDC23

Target: CDC23 (Cell Division Cycle 23 (CDC23))

Andere Bezeichnung: CDC23

Hintergrund: CDC23 shares strong similarity with Saccharomyces cerevisiae Cdc23, a protein essential for cell cycle progression through the G2/M transition. This protein is a component of anaphase-promoting complex (APC), which is composed of eight protein subunits and highly conserved in eukaryotic cells. APC catalyzes the formation of cyclin B-ubiquitin conjugate that is responsible for the ubiquitin-mediated proteolysis of B-type cyclins. This protein and 3 other members of the APC complex contain the TPR (tetratricopeptide repeat), a protein domain important for protein-protein interaction.

Molekulargewicht: 66 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus