RNF165 Antikörper (N-Term)

Produktnummer ABIN629725

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch RNF165 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für RNF165 Antikörper (N-Term) (ABIN629725)

Target: RNF165 (Ring Finger Protein 165 (RNF165))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RNF165 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RNF165 Antikörper

Bindungsspezifität: N-Term

Spezifität: RNF165 antibody was raised against the N terminal of RNF165

Aufreinigung: Purified

Immunogen: RNF165 antibody was raised using the N terminal of RNF165 corresponding to a region with amino acids MVLVHVGYLVLPVFGSVRNRGAPFQRSQHPHATSCRHFHLGPPQPQQLAP

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RNF165 Blocking Peptide, (ABIN5615891), is also available for use as a blocking control in assays to test for specificity of this RNF165 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF165 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RNF165

Target: RNF165 (Ring Finger Protein 165 (RNF165))

Andere Bezeichnung: RNF165

Hintergrund: RNF165 is encoded in regions involved in pericentric inversions in patients with bipolar affective disorder.Encoded in regions involved in pericentric inversions in patients with bipolar affective disorder.Encoded in regions involved in pericentric inversions in patients with bipolar affective disorder.

Molekulargewicht: 39 kDa (MW of target protein)