ATP7A Antikörper

Produktnummer ABIN629724

Produktdetails anti-ATP7A Antikörper

Target: ATP7A (ATPase, Cu++ Transporting, alpha Polypeptide (ATP7A))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATP7A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: ATP7 A antibody was raised using a synthetic peptide corresponding to a region with amino acids MKKQIEAMGFPAFVKKQPKYLKLGAIDVERLKNTPVKSSEGSQQRSPSYQ

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ATP7A

Target: ATP7A (ATPase, Cu++ Transporting, alpha Polypeptide (ATP7A))

Andere Bezeichnung: ATP7A (ATP7A Produkte)

Synonyme: ATP7A antikoerper, cal antikoerper, wu:fc43e01 antikoerper, zgc:153422 antikoerper, zgc:158633 antikoerper, DDBDRAFT_0218568 antikoerper, DDBDRAFT_0235190 antikoerper, DDB_0218568 antikoerper, DDB_0235190 antikoerper, atpase antikoerper, Atp7a antikoerper, kal antikoerper, atp7a antikoerper, DSMAX antikoerper, MK antikoerper, MNK antikoerper, SMAX3 antikoerper, Blo antikoerper, DXHXS1608e antikoerper, I14 antikoerper, Mo antikoerper, blotchy antikoerper, br antikoerper, brindled antikoerper, mottled antikoerper, Mnk antikoerper, ATPase copper transporting alpha antikoerper, ATPase, Cu++ transporting, alpha polypeptide antikoerper, P-type ATPase antikoerper, ATP synthase subunit a antikoerper, copper-transporting ATPase 1 antikoerper, ATP7A antikoerper, atp7a antikoerper, LOC100049514 antikoerper, Atp7a antikoerper, LOC412379 antikoerper

Hintergrund: The ATP7A gene encodes the Menkes copper-translocating P-type ATPase, a ubiquitous protein that regulates the absorption of copper in the gastrointestinal tract. Inside cells, this protein has a dual function: it delivers copper to cuproenzymes in the Golgi compartment and effluxes excess copper. The trafficking mechanism and catalytic activity combine to facilitate absorption and intercellular transport of copper. Menkes disease, a systemic copper deficiency disorder, is caused by mutations in the ATP7A gene.

Molekulargewicht: 30 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Ribonucleoside Biosynthetic Process