HMGCS2 Antikörper

Produktnummer ABIN629712

Der Kaninchen Polyklonal anti-HMGCS2 Antikörper (ABIN629712) detektiert spezifisch HMGCS2 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für HMGCS2 Antikörper (ABIN629712)

Target: HMGCS2 (3-Hydroxy-3-Methylglutaryl-CoA Synthase 2 (Mitochondrial) (HMGCS2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HMGCS2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HMGCS2 Antikörper

Aufreinigung: Purified

Immunogen: HMGCS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPGDTNSLFPGTWYLE

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HMGCS2 Blocking Peptide, (ABIN937446), is also available for use as a blocking control in assays to test for specificity of this HMGCS2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HMGCS2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HMGCS2

Target: HMGCS2 (3-Hydroxy-3-Methylglutaryl-CoA Synthase 2 (Mitochondrial) (HMGCS2))

Andere Bezeichnung: HMGCS2

Hintergrund: This enzyme condenses acetyl-CoA with acetoacetyl-CoA to form HMG-CoA, which is the substrate for HMG-CoA reductase.

Molekulargewicht: 56 kDa (MW of target protein)

Pathways: Response to Growth Hormone Stimulus, Cellular Response to Molecule of Bacterial Origin, Regulation of Lipid Metabolism by PPARalpha