WDR13 Antikörper (N-Term)

Produktnummer ABIN629704

Produktdetails anti-WDR13 Antikörper

Target: WDR13 (WD Repeat Domain 13 (WDR13))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WDR13 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: WDR13 antibody was raised against the N terminal of WDR13

Aufreinigung: Purified

Immunogen: WDR13 antibody was raised using the N terminal of WDR13 corresponding to a region with amino acids GQRYGPLSEPGSARAYSNSIVRSSRTTLDRMEDFEDDPRALGARGHRRSV

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WDR13 Blocking Peptide, catalog no. 33R-3511, is also available for use as a blocking control in assays to test for specificity of this WDR13 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR13 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WDR13

Target: WDR13 (WD Repeat Domain 13 (WDR13))

Andere Bezeichnung: WDR13 (WDR13 Produkte)

Synonyme: MGC80988 antikoerper, MGC79608 antikoerper, WDR13 antikoerper, DKFZp469E2032 antikoerper, MG21 antikoerper, 1700060B08Rik antikoerper, 5730411P10Rik antikoerper, DXHXS7467e antikoerper, W51679 antikoerper, mMg21 antikoerper, RGD1560982 antikoerper, WD repeat domain 13 L homeolog antikoerper, WD repeat domain 13 antikoerper, wdr13.L antikoerper, wdr13 antikoerper, WDR13 antikoerper, Wdr13 antikoerper

Hintergrund: WDR13 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. WDR13 gene is widely expressed in various tissues, and located in chromosome X. The function of this gene has not been determined.

Molekulargewicht: 53 kDa (MW of target protein)