UXT Antikörper (N-Term)

Produktnummer ABIN629698

Produktdetails anti-UXT Antikörper

Target: UXT (Ubiquitously-Expressed, Prefoldin-Like Chaperone (UXT))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UXT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: UXT antibody was raised against the N terminal of UXT

Aufreinigung: Purified

Immunogen: UXT antibody was raised using the N terminal of UXT corresponding to a region with amino acids MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYL

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UXT Blocking Peptide, catalog no. 33R-5785, is also available for use as a blocking control in assays to test for specificity of this UXT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UXT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UXT

Target: UXT (Ubiquitously-Expressed, Prefoldin-Like Chaperone (UXT))

Andere Bezeichnung: UXT (UXT Produkte)

Synonyme: zgc:101894 antikoerper, 0910002B17Rik antikoerper, ART-27 antikoerper, STAP1 antikoerper, ubiquitously-expressed, prefoldin-like chaperone antikoerper, ubiquitously expressed prefoldin like chaperone antikoerper, ubiquitously-expressed transcript antikoerper, ubiquitously expressed transcript antikoerper, uxt antikoerper, UXT antikoerper, Uxt antikoerper

Hintergrund: UXT is a novel protein which is highly conserved in mouse. It interacts with the N-terminus of the androgen receptor and plays a role in facilitating receptor-induced transcriptional activation. It is also likely to be involved in tumorigenesis as it is abundantly expressed in tumor tissues.

Molekulargewicht: 18 kDa (MW of target protein)

Pathways: Unfolded Protein Response