CA8 Antikörper (N-Term)

Produktnummer ABIN629695

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch CA8 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus, Ratte, Hund und Zebrafisch (Danio rerio).

Kurzübersicht für CA8 Antikörper (N-Term) (ABIN629695)

Target: CA8 (Carbonic Anhydrase VIII (CA8))

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CA8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CA8 Antikörper

Bindungsspezifität: N-Term

Spezifität: Carbonic Anhydrase VIII antibody was raised against the N terminal of CA8

Aufreinigung: Purified

Immunogen: Carbonic Anhydrase VIII antibody was raised using the N terminal of CA8 corresponding to a region with amino acids YEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDC

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Carbonic Anhydrase VIII Blocking Peptide, (ABIN936043), is also available for use as a blocking control in assays to test for specificity of this Carbonic Anhydrase VIII antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CA8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CA8

Target: CA8 (Carbonic Anhydrase VIII (CA8))

Andere Bezeichnung: Carbonic Anhydrase VIII

Hintergrund: CA8 was initially named CA-related protein because of sequence similarity to other known carbonic anhydrase genes. However, CA8 lacks carbonic anhydrase activity (i.e., the reversible hydration of carbon dioxide). CA8 continues to carry a carbonic anhydrase designation based on clear sequence identity to other members of the carbonic anhydrase gene family.

Molekulargewicht: 32 kDa (MW of target protein)