PPIF Antikörper

Produktnummer ABIN629692

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch PPIF in WB. Er zeigt eine Reaktivität gegenüber Human, Ratte und Hund.

Kurzübersicht für PPIF Antikörper (ABIN629692)

Target: PPIF (Peptidylprolyl Isomerase F (PPIF))

Reaktivität: Human, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPIF Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PPIF Antikörper

Aufreinigung: Purified

Immunogen: PPIF antibody was raised using a synthetic peptide corresponding to a region with amino acids GSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLS

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PPIF Blocking Peptide, (ABIN938975), is also available for use as a blocking control in assays to test for specificity of this PPIF antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIF antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PPIF

Target: PPIF (Peptidylprolyl Isomerase F (PPIF))

Andere Bezeichnung: PPIF

Hintergrund: PPIF is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is part of the mitochondrial permeability transition pore in the inner mitochondrial membrane. Activation of this pore is thought to be involved in the induction of apoptotic and necrotic cell death.

Molekulargewicht: 19 kDa (MW of target protein)

Pathways: Proton Transport, Negative Regulation of intrinsic apoptotic Signaling, Negative Regulation of Transporter Activity