ECH1 Antikörper (N-Term)

Produktnummer ABIN629677

Produktdetails anti-ECH1 Antikörper

Target: ECH1 (Enoyl Coenzyme A Hydratase 1, Peroxisomal (ECH1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ECH1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ECH1 antibody was raised against the N terminal of ECH1

Aufreinigung: Purified

Immunogen: ECH1 antibody was raised using the N terminal of ECH1 corresponding to a region with amino acids PDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDA

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ECH1 Blocking Peptide, catalog no. 33R-7014, is also available for use as a blocking control in assays to test for specificity of this ECH1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECH1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ECH1

Target: ECH1 (Enoyl Coenzyme A Hydratase 1, Peroxisomal (ECH1))

Andere Bezeichnung: ECH1 (ECH1 Produkte)

Synonyme: HPXEL antikoerper, Pxel antikoerper, AA617331 antikoerper, enoyl-CoA hydratase 1, peroxisomal antikoerper, enoyl CoA hydratase 1, peroxisomal antikoerper, enoyl-CoA hydratase 1 antikoerper, delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial antikoerper, enoyl-CoA hydratase 1, peroxisomal L homeolog antikoerper, enoyl coenzyme A hydratase 1, peroxisomal antikoerper, ech1 antikoerper, ECH1 antikoerper, LOC747511 antikoerper, ech1.L antikoerper, Ech1 antikoerper

Hintergrund: ECH1 is a member of the hydratase/isomerase superfamily. ECH1 shows high sequence similarity to enoyl-coenzyme A (CoA) hydratases of several species, particularly within a conserved domain characteristic of these proteins. The protein contains a C-terminal peroxisomal targeting sequence, localizes to the peroxisome. This enzyme functions in the auxiliary step of the fatty acid beta-oxidation pathway.

Molekulargewicht: 36 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process