ECH1 Antikörper (N-Term)

Produktnummer ABIN629677

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch ECH1 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für ECH1 Antikörper (N-Term) (ABIN629677)

Target: ECH1 (Enoyl Coenzyme A Hydratase 1, Peroxisomal (ECH1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ECH1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ECH1 Antikörper

Bindungsspezifität: N-Term

Spezifität: ECH1 antibody was raised against the N terminal of ECH1

Aufreinigung: Purified

Immunogen: ECH1 antibody was raised using the N terminal of ECH1 corresponding to a region with amino acids PDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDA

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ECH1 Blocking Peptide, (ABIN5613294), is also available for use as a blocking control in assays to test for specificity of this ECH1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECH1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ECH1

Target: ECH1 (Enoyl Coenzyme A Hydratase 1, Peroxisomal (ECH1))

Andere Bezeichnung: ECH1

Hintergrund: ECH1 is a member of the hydratase/isomerase superfamily. ECH1 shows high sequence similarity to enoyl-coenzyme A (CoA) hydratases of several species, particularly within a conserved domain characteristic of these proteins. The protein contains a C-terminal peroxisomal targeting sequence, localizes to the peroxisome. This enzyme functions in the auxiliary step of the fatty acid beta-oxidation pathway.

Molekulargewicht: 36 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process