ALAS2 Antikörper

Produktnummer ABIN629674

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch ALAS2 in WB und IHC. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für ALAS2 Antikörper (ABIN629674)

Target: ALAS2 (Aminolevulinate, delta-, Synthase 2 (ALAS2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ALAS2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-ALAS2 Antikörper

Aufreinigung: Purified

Immunogen: ALAS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFKTVNRWADAYPFAQHFSEASVASKDVSVWCSNDYLGMSRHPQVLQATQ

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ALAS2 Blocking Peptide, (ABIN5612004), is also available for use as a blocking control in assays to test for specificity of this ALAS2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALAS2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ALAS2

Target: ALAS2 (Aminolevulinate, delta-, Synthase 2 (ALAS2))

Andere Bezeichnung: ALAS2

Hintergrund: ALAS2 specifies an erythroid-specific mitochondrially located enzyme. The protein catalyzes the first step in the heme biosynthetic pathway. Defects in its gene cause X-linked pyridoxine-responsive sideroblastic anemia.

Molekulargewicht: 57 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis