ALAS2 Antikörper
-
- Target Alle ALAS2 Antikörper anzeigen
- ALAS2 (Aminolevulinate, delta-, Synthase 2 (ALAS2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ALAS2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- ALAS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFKTVNRWADAYPFAQHFSEASVASKDVSVWCSNDYLGMSRHPQVLQATQ
- Top Product
- Discover our top product ALAS2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ALAS2 Blocking Peptide, catalog no. 33R-9531, is also available for use as a blocking control in assays to test for specificity of this ALAS2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALAS2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ALAS2 (Aminolevulinate, delta-, Synthase 2 (ALAS2))
- Andere Bezeichnung
- ALAS2 (ALAS2 Produkte)
- Synonyme
- anh1 antikoerper, asb antikoerper, xlsa antikoerper, ALAS-E antikoerper, ALASE antikoerper, ANH1 antikoerper, ASB antikoerper, XLDPP antikoerper, XLEPP antikoerper, XLSA antikoerper, alas-e antikoerper, cb1063 antikoerper, sau antikoerper, sauternes antikoerper, ALAS antikoerper, Alas-2 antikoerper, 5'-aminolevulinate synthase 2 antikoerper, aminolevulinate, delta-, synthase 2 antikoerper, aminolevulinic acid synthase 2, erythroid antikoerper, alas2 antikoerper, ALAS2 antikoerper, Alas2 antikoerper, alas2.L antikoerper
- Hintergrund
- ALAS2 specifies an erythroid-specific mitochondrially located enzyme. The protein catalyzes the first step in the heme biosynthetic pathway. Defects in its gene cause X-linked pyridoxine-responsive sideroblastic anemia.
- Molekulargewicht
- 57 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-