UBE2I Antikörper
-
- Target Alle UBE2I Antikörper anzeigen
- UBE2I (Ubiquitin-Conjugating Enzyme E2I (UBE2I))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UBE2I Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- UBE2 I antibody was raised using a synthetic peptide corresponding to a region with amino acids KDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRA
- Top Product
- Discover our top product UBE2I Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
UBE2I Blocking Peptide, catalog no. 33R-4311, is also available for use as a blocking control in assays to test for specificity of this UBE2I antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UBE2I (Ubiquitin-Conjugating Enzyme E2I (UBE2I))
- Andere Bezeichnung
- UBE2I (UBE2I Produkte)
- Synonyme
- C358B7.1 antikoerper, P18 antikoerper, UBC9 antikoerper, ubc9 antikoerper, ube2ia antikoerper, zUbc9 antikoerper, 5830467E05Rik antikoerper, F830028O17Rik antikoerper, Ubce2i antikoerper, Ubce9 antikoerper, UbcE2A antikoerper, ubce9 antikoerper, T13J8.70 antikoerper, T13J8_70 antikoerper, UBIQUITIN-PROTEIN LIGASE antikoerper, ubiquitin conjugating enzyme 9 antikoerper, ubiquitin conjugating enzyme E2 I antikoerper, ubiquitin-conjugating enzyme E2Ib antikoerper, ubiquitin-conjugating enzyme E2L antikoerper, ubiquitin-conjugating enzyme E2I antikoerper, ubiquitin conjugating enzyme E2I S homeolog antikoerper, ubiquitin conjugating enzyme 9 antikoerper, SUMO-conjugating enzyme UBC9 antikoerper, UBE2I antikoerper, ube2ib antikoerper, UBE2L antikoerper, Ube2i antikoerper, ube2i.S antikoerper, UBC9 antikoerper, ubc-9 antikoerper, LOC108703134 antikoerper
- Hintergrund
- The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2I is a member of the E2 ubiquitin-conjugating enzyme family.
- Molekulargewicht
- 52 kDa (MW of target protein)
- Pathways
- Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Ubiquitin Proteasome Pathway
-