UPB1 Antikörper (Middle Region)

Produktnummer ABIN629651

Der Kaninchen Polyklonal Anti-UPB1-Antikörper wurde für WB validiert. Er ist geeignet, UPB1 in Proben von Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio), Drosophila melanogaster, Arabidopsis und C. elegans zu detektieren.

Kurzübersicht für UPB1 Antikörper (Middle Region) (ABIN629651)

Target: UPB1 (Ureidopropionase, beta (UPB1))

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio), Drosophila melanogaster, Arabidopsis, C. elegans

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UPB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-UPB1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: UPB1 antibody was raised against the middle region of UPB1

Aufreinigung: Purified

Immunogen: UPB1 antibody was raised using the middle region of UPB1 corresponding to a region with amino acids AVVISNSGAVLGKTRKNHIPRVGDFNESTYYMEGNLGHPVFQTQFGRIAV

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UPB1 Blocking Peptide, (ABIN937005), is also available for use as a blocking control in assays to test for specificity of this UPB1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UPB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UPB1

Target: UPB1 (Ureidopropionase, beta (UPB1))

Andere Bezeichnung: UPB1

Hintergrund: UPB1 is a protein that belongs to the CN hydrolase family. Beta-ureidopropionase catalyzes the last step in the pyrimidine degradation pathway. The pyrimidine bases uracil and thymine are degraded via the consecutive action of dihydropyrimidine dehydrogenase (DHPDH), dihydropyrimidinase (DHP) and beta-ureidopropionase (UP) to beta-alanine and beta-aminoisobutyric acid, respectively. UP deficiencies are associated with N-carbamyl-beta-amino aciduria and may lead to abnormalities in neurological activity.

Molekulargewicht: 42 kDa (MW of target protein)