WDR4 Antikörper (C-Term)

Produktnummer ABIN629640

Dieses Anti-WDR4-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von WDR4 in WB und IHC. Geeignet für Human.

Kurzübersicht für WDR4 Antikörper (C-Term) (ABIN629640)

Target: WDR4 (WD Repeat Domain 4 (WDR4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WDR4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-WDR4 Antikörper

Bindungsspezifität: C-Term

Spezifität: WDR4 antibody was raised against the C terminal of WDR4

Aufreinigung: Purified

Immunogen: WDR4 antibody was raised using the C terminal of WDR4 corresponding to a region with amino acids AGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHA

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WDR4 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this WDR4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WDR4

Target: WDR4 (WD Repeat Domain 4 (WDR4))

Andere Bezeichnung: WDR4

Hintergrund: WDR4 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.

Molekulargewicht: 45 kDa (MW of target protein)