NAMPT Antikörper (C-Term)
-
- Target Alle NAMPT Antikörper anzeigen
- NAMPT (Nicotinamide phosphoribosyltransferase (NAMPT))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Ratte, Maus, Zebrafisch (Danio rerio), Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NAMPT Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PBEF1 antibody was raised against the C terminal of PBEF1
- Aufreinigung
- Purified
- Immunogen
- PBEF1 antibody was raised using the C terminal of PBEF1 corresponding to a region with amino acids CSYVVTNGLGINVFKDPVADPNKRSKKGRLSLHRTPAGNFVTLEEGKGDL
- Top Product
- Discover our top product NAMPT Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PBEF1 Blocking Peptide, catalog no. 33R-1818, is also available for use as a blocking control in assays to test for specificity of this PBEF1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PBEF1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NAMPT (Nicotinamide phosphoribosyltransferase (NAMPT))
- Andere Bezeichnung
- PBEF1 (NAMPT Produkte)
- Synonyme
- 1110035O14Rik antikoerper, PBEF antikoerper, PBEF1 antikoerper, VF antikoerper, VISFATIN antikoerper, AI314458 antikoerper, AI480535 antikoerper, NAmPRTase antikoerper, Pbef antikoerper, Pbef1 antikoerper, Visfatin antikoerper, visfatin antikoerper, pbef antikoerper, pbef1 antikoerper, nicotinamide phosphoribosyltransferase antikoerper, Nicotinamide phosphoribosyltransferase antikoerper, nicotinamide phosphoribosyltransferase S homeolog antikoerper, NAMPT antikoerper, Nampt antikoerper, nampt antikoerper, Smon_0680 antikoerper, Mrub_2845 antikoerper, Cseg_3704 antikoerper, BC1002_3997 antikoerper, Ftrac_2686 antikoerper, Varpa_5681 antikoerper, Celal_3900 antikoerper, Deima_0880 antikoerper, BC1001_3724 antikoerper, Celly_1696 antikoerper, Clole_1542 antikoerper, Tsp_05934 antikoerper, nampt.S antikoerper
- Hintergrund
- PBEF1 catalyzes the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, one step in the biosynthesis of nicotinamide adenine dinucleotide. The protein is an adipokine that is localized to the bloodstream and has various functions, including the promotion of vascular smooth muscle cell maturation and inhibition of neutrophil apoptosis. It also activates insulin receptor and has insulin-mimetic effects, lowering blood glucose and improving insulin sensitivity. The protein is highly expressed in visceral fat and serum levels of the protein correlate with obesity.
- Molekulargewicht
- 54 kDa (MW of target protein)
-