CBS Antikörper (N-Term)

Produktnummer ABIN629598

Dieses Anti-CBS-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von CBS in WB und IHC. Geeignet für Human, Maus, Ratte und Hund. Dieses Primary Antibody wurde in 1 Publikation zitiert.

Kurzübersicht für CBS Antikörper (N-Term) (ABIN629598)

Target: CBS (Cystathionine-beta-Synthase (CBS))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CBS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-CBS Antikörper

Bindungsspezifität: N-Term

Spezifität: CBS antibody was raised against the N terminal of CBS

Aufreinigung: Purified

Immunogen: CBS antibody was raised using the N terminal of CBS corresponding to a region with amino acids RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CBS Blocking Peptide, (ABIN5612699), is also available for use as a blocking control in assays to test for specificity of this CBS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CBS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Referenzen für anti-CBS Antikörper (ABIN629598)

Veerareddy, Dao, Yun, Stokes, Disbrow, Kevil, Cvek, Trutschl, Kilgore, Ramanathan, Zivadinov, Alexander: "Dysregulated Sulfide Metabolism in Multiple Sclerosis: Serum and Vascular Endothelial Inflammatory Responses." in: Pathophysiology : the official journal of the International Society for Pathophysiology, Vol. 29, Issue 3, pp. 570-582, (2022) (PubMed).

Details zu CBS

Target: CBS (Cystathionine-beta-Synthase (CBS))

Andere Bezeichnung: CBS

Hintergrund: CBS is involved in the transsulfuration pathway. The first step of this pathway, from homocysteine to cystathionine, is catalyzed by this protein. CBS deficiency can cause homocystinuria which affects many organs and tissues, including the eyes and the skeletal, vascular and central nervous systems.

Molekulargewicht: 60 kDa (MW of target protein)