MBD1 Antikörper (C-Term)

Produktnummer ABIN629581

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch MBD1 in WB. Er zeigt eine Reaktivität gegenüber Human und Hund.

Kurzübersicht für MBD1 Antikörper (C-Term) (ABIN629581)

Target: MBD1 (Methyl-CpG Binding Domain Protein 1 (MBD1))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MBD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MBD1 Antikörper

Bindungsspezifität: C-Term

Spezifität: MBD1 antibody was raised against the C terminal of MBD1

Aufreinigung: Purified

Immunogen: MBD1 antibody was raised using the C terminal of MBD1 corresponding to a region with amino acids VKQEPPDPEEDKEENKDDSASKLAPEEEAGGAGTPVITEIFSLGGTRFRD

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MBD1 Blocking Peptide, (ABIN5614686), is also available for use as a blocking control in assays to test for specificity of this MBD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MBD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MBD1

Target: MBD1 (Methyl-CpG Binding Domain Protein 1 (MBD1))

Andere Bezeichnung: MBD1

Hintergrund: MBD1 belongs to a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MBD1 can also repress transcription from methylated gene promoters. Five transcript variants of the MBD1 are generated by alternative splicing resulting in protein isoforms that contain one MBD domain, two to three cysteine-rich (CXXC) domains, and some differences in the COOH terminus.

Molekulargewicht: 60 kDa (MW of target protein)