Neuromedin B Antikörper (AA 25-55) (Biotin)

Produktnummer ABIN6294425

Der Kaninchen Polyklonal Anti-Neuromedin B-Antikörper wurde für ELISA validiert. Er ist geeignet, Neuromedin B in Proben von Human zu detektieren.

Kurzübersicht für Neuromedin B Antikörper (AA 25-55) (Biotin) (ABIN6294425)

Target: Neuromedin B

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Neuromedin B Antikörper ist konjugiert mit Biotin

Applikation: ELISA

Produktdetails anti-Neuromedin B Antikörper (Biotin)

Bindungsspezifität: AA 25-55

Verwendungszweck: Rabbit Anti-Human NMB (25-55aa) Antibody [+Biotin],

Immunogen: This antibody was produced from antiserum of rabbits immunized with a synthetic immunogen (NMB:25-55aa):APLSWDLPEPRSRASKIRVHSRGNLWATGHFC ).This antibody was produced from a rabbit immunized with this peptide conjugated with KLH.The IgG fraction of tissue culture supernatant was purified by Protein A affinity chromatography.

Anwendungsinformationen

Applikationshinweise: ELISA (recommended work dilution= 1:64,000)

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Rekonstitution: A separate vial of dilution buffer is provided for reconstitution. The antibody is supplied lyophilized, originally containing PBS, without preservative stabilizers (e.g. sodium azide). The final amount is indicated on the shipping vial.

Lagerung: 4 °C,-20 °C,-80 °C

Informationen zur Lagerung: -20°C

Details zu Neuromedin B

Target: Neuromedin B

Andere Bezeichnung: Neuromedin-B

Hintergrund:

Target Description: Neuromedin B  (NMB) is a  bombesin-related  peptide  in mammals.  It was originally purified from pig spinal cord, and later shown to be present in human  central nervous system  and  gastrointestinal tract.

Gene Symbol: NMB

Gen-ID: 4828

UniProt: P08949