DEFB4A Antikörper (AA 4-41)

Produktnummer ABIN604437

Dieses Anti-DEFB4A-Antikörper ist ein Schaf Polyklonal-Antikörper zur Detektion von DEFB4A in ELISA und RIA. Geeignet für Human.

Kurzübersicht für DEFB4A Antikörper (AA 4-41) (ABIN604437)

Target: DEFB4A (DEFB4) (Defensin, beta 4A (DEFB4))

Reaktivität: Human

Wirt: Schaf

Klonalität: Polyklonal

Konjugat: Dieser DEFB4A Antikörper ist unkonjugiert

Applikation: ELISA, Radioimmunoassay (RIA)

Produktdetails anti-DEFB4A Antikörper

Bindungsspezifität: AA 4-41

Spezifität: Recognizes human beta-Defensin 2 (epitope: aa 4-41).

Homologie: Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla (100%) Gibbon, Monkey (97%) Orangutan (81%).

Aufreinigung: Protein G purified

Immunogen: Synthetic human -Defensin 2 (aa 4-41)(DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla (100%), Gibbon, Monkey (97%), Orangutan (81%).

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Approved: ELISA (1:5000), RIA

Usage: Suitable for use in ELISA and RIA. ELISA: 1:5000.

Kommentare:

Target Species of Antibody: Human

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Sterile buffer or distilled water

Konzentration: Lot specific

Buffer: Lyophilized from 50 mM Tris,  pH 7.4

Lagerung: -20 °C

Informationen zur Lagerung: Lyophilized powder may be stored at -20°C. Aliquot and store at -20°C. Reconstituted product is stable for 1 year at -20°C.

Details zu DEFB4A

Target: DEFB4A (DEFB4) (Defensin, beta 4A (DEFB4))

Andere Bezeichnung: DEFB4A / DEFB2

Hintergrund: Name/Gene ID: DEFB4A

Synonyms: DEFB4A, Beta-defensin 2, Beta-defensin 4A, DEFB-2, DEFB102, Defensin, beta 2, Defensin, beta 4, Defensin, beta 4A, DEFB4, DEFB2, HBD-2, Skin-antimicrobial peptide 1, BD-2, SAP1

Gen-ID: 1673