IFNAR1 Antikörper (AA 263-306)

Produktnummer ABIN5708183

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch IFNAR1 in WB. Er zeigt eine Reaktivität gegenüber Human und Maus.

Kurzübersicht für IFNAR1 Antikörper (AA 263-306) (ABIN5708183)

Target: IFNAR1 (Interferon alpha/beta Receptor 1 (IFNAR1))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IFNAR1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-IFNAR1 Antikörper

Bindungsspezifität: AA 263-306

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 263-306 (HAFLKRNPGNHLYKWKQIPDCENVKTTQCVFPQNVFQKGIYLLR) from the human protein were used as the immunogen for the IFNAR1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the IFNAR1 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the IFNAR1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu IFNAR1

Target: IFNAR1 (Interferon alpha/beta Receptor 1 (IFNAR1))

Andere Bezeichnung: IFNAR1 / Interferon alpha receptor 1

Hintergrund: Interferon-alpha/beta receptor alpha chain is a protein that in humans is encoded by the IFNAR1 gene. The protein encoded by this gene is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulates Janus protein kinases, which in turn phosphorylate several proteins, including STAT1 and STAT2. The encoded protein also functions as an antiviral factor.

UniProt: P17181

Pathways: JAK-STAT Signalweg, Hepatitis C