Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

ErbB2/Her2 Antikörper (AA 29-64)

Der Kaninchen Polyklonal anti-ErbB2/Her2 Antikörper wird verwendet zum Nachweis von ErbB2/Her2 in Proben von Human und Ratte. Er wurde validiert für WB und IHC (p).
Produktnummer ABIN5708082
644,88 €
Zzgl. Versandkosten 20,00 € und MwSt
100 μg
Lieferung nach: Deutschland
Lieferung in 6 bis 8 Werktagen

Kurzübersicht für ErbB2/Her2 Antikörper (AA 29-64) (ABIN5708082)

Target

Alle ErbB2/Her2 Antikörper anzeigen
ErbB2/Her2 (Receptor tyrosine-protein kinase erbB-2 (ErbB2/Her2))

Reaktivität

  • 564
  • 124
  • 119
  • 33
  • 8
  • 5
  • 3
  • 3
  • 3
  • 3
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Human, Ratte

Wirt

  • 305
  • 208
  • 61
  • 10
  • 6
  • 3
  • 2
  • 2
  • 1
Kaninchen

Klonalität

  • 312
  • 281
  • 3
Polyklonal

Konjugat

  • 351
  • 28
  • 24
  • 8
  • 8
  • 8
  • 8
  • 8
  • 8
  • 8
  • 8
  • 8
  • 8
  • 7
  • 7
  • 7
  • 7
  • 7
  • 6
  • 6
  • 6
  • 6
  • 6
  • 6
  • 6
  • 6
  • 6
  • 6
  • 5
  • 5
  • 3
  • 2
  • 2
  • 1
  • 1
Dieser ErbB2/Her2 Antikörper ist unkonjugiert

Applikation

  • 314
  • 142
  • 138
  • 134
  • 131
  • 93
  • 80
  • 60
  • 59
  • 52
  • 49
  • 30
  • 30
  • 12
  • 9
  • 8
  • 6
  • 5
  • 3
  • 3
  • 2
  • 2
  • 2
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
  • Bindungsspezifität

    • 41
    • 38
    • 34
    • 28
    • 25
    • 24
    • 21
    • 17
    • 17
    • 15
    • 13
    • 12
    • 9
    • 6
    • 5
    • 5
    • 5
    • 5
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    AA 29-64

    Aufreinigung

    Antigen affinity purified

    Immunogen

    Amino acids 29-64 (TDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTY) from the human protein were used as the immunogen for the HER2 antibody.

    Isotyp

    IgG
  • Applikationshinweise

    Optimal dilution of the HER2 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

    Beschränkungen

    Nur für Forschungszwecke einsetzbar
  • Buffer

    0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

    Lagerung

    -20 °C

    Informationen zur Lagerung

    After reconstitution, the HER2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Target

    ErbB2/Her2 (Receptor tyrosine-protein kinase erbB-2 (ErbB2/Her2))

    Andere Bezeichnung

    HER2 / ErbB 2

    Hintergrund

    Receptor tyrosine-protein kinase erbB-2, also known as CD340 (cluster of differentiation 340), proto-oncogene Neu, Erbb2 (rodent), or ERBB2 (human), is a protein that in humans is encoded by the ERBB2 gene. And it is also frequently called HER2 (from human epidermal growth factor receptor 2) or HER2/neu. This gene encodes a member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases. This protein has no ligand binding domain of its own and therefore cannot bind growth factors. Amplification and/or overexpression of this gene has been reported in numerous cancers, including breast and ovarian tumors. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized.

    UniProt

    P04626

    Pathways

    RTK Signalweg, Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Skeletal Muscle Fiber Development
Sie sind hier:
Chat with us!