JunD Antikörper

Produktnummer ABIN5693269

Produktdetails anti-JunD Antikörper

Target: JunD (JUND) (Jun D Proto-Oncogene (JUND))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser JunD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Marke: Picoband™

Sequenz: TASLLREQVA QLKQKVLSHV NSGCQLLPQH QVPAY

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for JunD detection. Tested with WB in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of human JunD (TASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY).

Anwendungsinformationen

Applikationshinweise:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot,0.1-0.5 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Details zu JunD

Target: JunD (JUND) (Jun D Proto-Oncogene (JUND))

Andere Bezeichnung: JUND (JUND Produkte)

Synonyme: si:dkey-251j8.3 antikoerper, AP-1 antikoerper, Jund1 antikoerper, JunD proto-oncogene, AP-1 transcription factor subunit antikoerper, jun D proto-oncogene S homeolog antikoerper, jun D proto-oncogene antikoerper, jund antikoerper, jund.S antikoerper, JUND antikoerper, Jund antikoerper

Hintergrund:

Synonyms: Transcription factor jun-D, JUND

Background: Transcription factor JunD is a protein that in humans is encoded by the JUND gene. The protein encoded by this intronless gene is a member of the JUN family, and a functional component of the AP1 transcription factor complex. This protein has been proposed to protect cells from p53-dependent senescence and apoptosis. Alternative translation initiation site usage results in the production of different isoforms.

UniProt: P17535