KDM2A Antikörper
-
- Target Alle KDM2A Antikörper anzeigen
- KDM2A (Lysine (K)-Specific Demethylase 2A (KDM2A))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KDM2A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Marke
- Picoband™
- Sequenz
- KRTFDLEEKL HTNKYNANFV TFMEGKDFNV EYIQR
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
- Rabbit IgG polyclonal antibody for FBXL11 detection. Tested with WB in Human,Mouse,Rat.
- Immunogen
- A synthetic peptide corresponding to a sequence of human FBXL11 (KRTFDLEEKLHTNKYNANFVTFMEGKDFNVEYIQR).
- Top Product
- Discover our top product KDM2A Primärantikörper
-
-
- Applikationshinweise
-
Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
Application Details: Western blot, 0.1-0.5 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- KDM2A (Lysine (K)-Specific Demethylase 2A (KDM2A))
- Andere Bezeichnung
- KDM2A (KDM2A Produkte)
- Synonyme
- FBXL11 antikoerper, JHDM1A antikoerper, 100043628 antikoerper, 5530401A10Rik antikoerper, AA589516 antikoerper, AW536790 antikoerper, Cxxc8 antikoerper, Fbl11 antikoerper, Fbl7 antikoerper, Fbxl11 antikoerper, Gm4560 antikoerper, Jhdm1 antikoerper, Jhdm1a antikoerper, lalina antikoerper, KDM2A antikoerper, CXXC8 antikoerper, FBL11 antikoerper, FBL7 antikoerper, LILINA antikoerper, fb76b11 antikoerper, wu:fb76b11 antikoerper, wu:fj11c04 antikoerper, zgc:158441 antikoerper, zgc:158606 antikoerper, lysine demethylase 2A antikoerper, lysine (K)-specific demethylase 2A antikoerper, lysine (K)-specific demethylase 2Aa antikoerper, KDM2A antikoerper, Kdm2a antikoerper, kdm2aa antikoerper
- Hintergrund
-
Synonyms: Lysine-specific demethylase 2A, CXXC-type zinc finger protein 8, F-box and leucine-rich repeat protein 11, F-box protein FBL7, F-box protein Lilina, F-box/LRR-repeat protein 11, JmjC domain-containing histone demethylation protein 1A, [Histone-H3]-lysine-36 demethylase 1A, KDM2A, CXXC8, FBL7, FBXL11, JHDM1A, KIAA1004
Tissue Specificity: Widely expressed, with highest levels in brain, testis and ovary, followed by lung.
Background: Lysine-specific demethylase 2A (KDM2A) also known as F-box and leucine-rich repeat protein 11 (FBXL11) is an enzyme that in humans is encoded by the KDM2A gene. This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains at least six highly degenerated leucine-rich repeats. This family member plays a role in epigenetic silencing. It nucleates at CpG islands and specifically demethylates both mono- and di-methylated lysine-36 of histone H3. Alternative splicing results in multiple transcript variants.
- UniProt
- Q9Y2K7
- Pathways
- Warburg Effekt
-