ABCB1 Antikörper

Produktnummer ABIN5693064

Produktdetails anti-ABCB1 Antikörper

Target: ABCB1 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 1 (ABCB1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ABCB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Sequenz: QAQDRKLSTK EALDESIPPV SFWRIMKLNL TEWPY

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for P Glycoprotein detection. Tested with WB in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of human P Glycoprotein (QAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWPY).

Anwendungsinformationen

Applikationshinweise:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot, 0.1-0.5 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-ABCB1 Antikörper (ABIN5693064)

Chen, Liu, Chen, Xu, Xiao, Hu, Mao, Wang: "A 20(S)-protopanoxadiol derivative overcomes multi-drug resistance by antagonizing ATP-binding cassette subfamily B member 1 transporter function." in: Oncotarget, Vol. 7, Issue 8, pp. 9388-403, (2017) (PubMed).

Details zu ABCB1

Target: ABCB1 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 1 (ABCB1))

Andere Bezeichnung: ABCB1 (ABCB1 Produkte)

Synonyme: ABC20 antikoerper, CD243 antikoerper, CLCS antikoerper, GP170 antikoerper, MDR1 antikoerper, P-GP antikoerper, PGY1 antikoerper, Abcb1 antikoerper, Mdr1a antikoerper, p-gp antikoerper, xemdr antikoerper, Mdr1 antikoerper, Mdr1b antikoerper, Pgy-1 antikoerper, Pgy1 antikoerper, mdr antikoerper, ABCB1 antikoerper, PGP1 antikoerper, ATP binding cassette subfamily B member 1 antikoerper, ATP binding cassette subfamily B member 1A antikoerper, ATP binding cassette subfamily B member 1 L homeolog antikoerper, ATP-binding cassette, sub-family B (MDR/TAP), member 1B antikoerper, ABCB1 antikoerper, Abcb1a antikoerper, abcb1.L antikoerper, Abcb1b antikoerper, Abcb1 antikoerper

Hintergrund:

Synonyms: Multidrug resistance protein 1, ATP-binding cassette sub-family B member 1, P-glycoprotein 1, CD243, ABCB1, MDR1, PGY1

Tissue Specificity: Expressed in liver, kidney, small intestine and brain.

Background: P-GP, also called ABCB1 or PGY1, is a glycoprotein that in humans is encoded by the ABCB1 gene. It is mapped to 7q21.12. P-GP is a well-characterized ABC-transporter (which transports a wide variety of substrates across extra- and intracellular membranes) of the MDR/TAP subfamily. It is an important protein of the cell membrane that pumps many foreign substances out of cells. More formally, it is an ATP-dependent drug efflux pump with broad substrate specificity. P-GP is an ATP-dependent drug efflux pump forxenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood-brain barrier.

UniProt: P08183