NADPH Oxidase 4 Antikörper

Produktnummer ABIN5692899

Produktdetails anti-NADPH Oxidase 4 Antikörper

Target: NADPH Oxidase 4 (NOX4)

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NADPH Oxidase 4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Marke: Picoband™

Sequenz: ILNTLLDDWK PYKLRRLYFI WVCRDIQSFR WFADLL

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for NADPH oxidase 4 detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of human NADPH oxidase 4 (ILNTLLDDWKPYKLRRLYFIWVCRDIQSFRWFADLL).

Anwendungsinformationen

Applikationshinweise:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-NADPH Oxidase 4 Antikörper (ABIN5692899)

Liu, Hong, Li, Ren, Wang, Xu, Shi, Xu: "A Cross Talk Between BRG1 and Males Absent on the First Contributes to Reactive Oxygen Species Production in a Mouse Model of Nonalcoholic Steatohepatitis." in: Antioxidants & redox signaling, (2018) (PubMed).

Meyer, Fredette, Daniel, Sharma, Amann, Arterburn, Barton, Prossnitz: "Obligatory role for GPER in cardiovascular aging and disease." in: Science signaling, Vol. 9, Issue 452, pp. ra105, (2017) (PubMed).

Details zu NADPH Oxidase 4

Target: NADPH Oxidase 4 (NOX4)

Andere Bezeichnung: NOX4 (NOX4 Produkte)

Synonyme: KOX antikoerper, KOX-1 antikoerper, RENOX antikoerper, AI648021 antikoerper, nox4 antikoerper, NOX4 antikoerper, NADPH oxidase 4 antikoerper, NOX4 antikoerper, Nox4 antikoerper, nox4 antikoerper, PTRG_09562 antikoerper

Hintergrund:

Synonyms: NADPH oxidase 4, Kidney oxidase-1, KOX-1, Kidney superoxide-producing NADPH oxidase, Renal NAD(P)H-oxidase, NOX4, RENOX

Tissue Specificity: Expressed by distal tubular cells in kidney cortex and in endothelial cells (at protein level). Widely expressed. Strongly expressed in kidney and to a lower extent in heart, adipocytes, hepatoma, endothelial cells, skeletal muscle, brain, several brain tumor cell lines and airway epithelial cells.

Background: NADPH oxidase 4 is an enzyme that in humans is encoded by the NOX4 gene, and is a member of the NOX family of NADPH oxidases. This gene encodes a member of the NOX-family of enzymes that functions as the catalytic subunit the NADPH oxidase complex. The encoded protein is localized to non-phagocytic cells where it acts as an oxygen sensor and catalyzes the reduction of molecular oxygen to various reactive oxygen species (ROS). The ROS generated by this protein have been implicated in numerous biological functions including signal transduction, cell differentiation and tumor cell growth. A pseudogene has been identified on the other arm of chromosome 11. Alternative splicing results in multiple transcript variants.

Pathways: Carbohydrate Homeostasis, Smooth Muscle Cell Migration