PVRL4 Antikörper (AA 53-94)

Produktnummer ABIN5647906

Der Kaninchen Polyklonal anti-PVRL4 Antikörper wird verwendet zum Nachweis von PVRL4 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für PVRL4 Antikörper (AA 53-94) (ABIN5647906)

Target: PVRL4 (Poliovirus Receptor-Related 4 (PVRL4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PVRL4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PVRL4 Antikörper

Bindungsspezifität: AA 53-94

Verwendungszweck: Nectin-4 Antibody / PVRL4

Sequenz: FYRGDSGEQV GQVAWARVDA GEGAQELALL HSKYGLHVSP AY

Aufreinigung: Antigen affinity

Immunogen: Amino acids 53-94 (FYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAY) from the human protein were used as the immunogen for the Nectin-4 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Differences in protocols and secondary/substrate sensitivity may require the Nectin-4 antibody to be titrated for optimal performance.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the Nectin-4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu PVRL4

Target: PVRL4 (Poliovirus Receptor-Related 4 (PVRL4))

Andere Bezeichnung: Nectin-4

Hintergrund: PVRL4, also known as Nectin-4, is expressed in human skin, hair follicles, and cultured keratinocytes, but not in fibroblasts. This gene encodes a member of the nectin family. The encoded protein contains two immunoglobulin-like (Ig-like) C2-type domains and one Ig-like V-type domain. It is involved in cell adhesion through trans-homophilic and -heterophilic interactions. It is a single-pass type I membrane protein. The soluble form is produced by proteolytic cleavage at the cell surface by the metalloproteinase ADAM17/TACE. The secreted form is found in both breast tumor cell lines and breast tumor patients. Mutations in this gene are the cause of ectodermal dysplasia-syndactyly syndrome type 1, an autosomal recessive disorder. Alternatively spliced transcript variants have been found but the full-length nature of the variant has not been determined.

UniProt: Q96NY8

Pathways: Cell-Cell Junction Organization