PDE5A Antikörper (AA 20-63)

Produktnummer ABIN5647895

Dieses Anti-PDE5A-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von PDE5A in WB und IHC (p). Geeignet für Human und Ratte.

Kurzübersicht für PDE5A Antikörper (AA 20-63) (ABIN5647895)

Target: PDE5A (phosphodiesterase 5A, cGMP-Specific (PDE5A))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PDE5A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-PDE5A Antikörper

Bindungsspezifität: AA 20-63

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 20-63 (QKQQQRDQDSVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVH) from the human protein were used as the immunogen for the PDE5A antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the PDE5A antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the PDE5A antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu PDE5A

Target: PDE5A (phosphodiesterase 5A, cGMP-Specific (PDE5A))

Andere Bezeichnung: PDE5

Hintergrund: CGMP-specific phosphodiesterase type 5 is an enzyme from the phosphodiesterase class. It is found in various tissues, most prominently the corpus cavernosum and the retina. It has also been recently discovered to play a vital role in the cardiovascular system. Furthermore, PDE5A also plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. This PDE5A gene is mapped to 4q26.

UniProt: O76074

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling