ETS1 Antikörper (AA 67-98)

Produktnummer ABIN5647852

Der Kaninchen Polyklonal Anti-ETS1-Antikörper wurde für WB validiert. Er ist geeignet, ETS1 in Proben von Human und Maus zu detektieren.

Kurzübersicht für ETS1 Antikörper (AA 67-98) (ABIN5647852)

Target: ETS1 (V-Ets erythroblastosis Virus E26 Oncogene Homolog 1 (Avian) (ETS1))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ETS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ETS1 Antikörper

Bindungsspezifität: AA 67-98

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 67-98 (KDPRQWTETHVRDWVMWAVNEFSLKGVDFQKF) from the human protein were used as the immunogen for the ETS1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the ETS1 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the ETS1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu ETS1

Target: ETS1 (V-Ets erythroblastosis Virus E26 Oncogene Homolog 1 (Avian) (ETS1))

Andere Bezeichnung: ETS1

Hintergrund: Protein C-ets-1 is a protein that in humans is encoded by the ETS1 gene. It is mapped to 11q24.3. This gene encodes a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. These proteins function either as transcriptional activators or repressors of numerous genes, and are involved in stem cell development, cell senescence and death, and tumorigenesis.

UniProt: P14921