OTC Antikörper (AA 33-70)

Produktnummer ABIN5647747

Produktdetails anti-OTC Antikörper

Target: OTC (Ornithine Carbamoyltransferase (OTC))

Bindungsspezifität: AA 33-70

Reaktivität: Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OTC Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Kreuzreaktivität (Details): Expected species reactivity: Human

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 33-70 (NKVQLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQK) from the human protein were used as the immunogen for the OTC antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the OTC antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the OTC antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu OTC

Target: OTC (Ornithine Carbamoyltransferase (OTC))

Andere Bezeichnung: OTC (Ornithine carbamoyltransferase) (OTC Produkte)

Hintergrund: Ornithine transcarbamylase (OTC) (also called ornithine carbamoyltransferase) is an enzyme that catalyzes the reaction between carbamoyl phosphate (CP) and ornithine (Orn) to form citrulline (Cit) and phosphate (Pi). This nuclear gene encodes a mitochondrial matrix enzyme. Missense, nonsense, and frameshift mutations in this enzyme lead to ornithine transcarbamylase deficiency, which causes hyperammonemia. Since the gene for this enzyme maps close to that for Duchenne muscular dystrophy, it may also play a role in that disease.

UniProt: P00480