OTC Antikörper (N-Term)

Produktnummer ABIN629690

Produktdetails anti-OTC Antikörper

Target: OTC (Ornithine Carbamoyltransferase (OTC))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OTC Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: OTC antibody was raised against the N terminal of OTC

Aufreinigung: Purified

Immunogen: OTC antibody was raised using the N terminal of OTC corresponding to a region with amino acids AFRNGHNFMVRNFRCGQPLQNKVQLKGRDLLTLKNFTGEEIKYMLWLSAD

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OTC Blocking Peptide, catalog no. 33R-1173, is also available for use as a blocking control in assays to test for specificity of this OTC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OTC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OTC

Target: OTC (Ornithine Carbamoyltransferase (OTC))

Andere Bezeichnung: OTC (OTC Produkte)

Synonyme: OCTD antikoerper, 2810428A13Rik antikoerper, AA589422 antikoerper, AW457381 antikoerper, OCT antikoerper, Plxn2 antikoerper, mKIAA0463 antikoerper, F1B16.13 antikoerper, F1B16_13 antikoerper, ORNITHINE CARBAMOYLTRANSFERASE antikoerper, ornithine carbamoyltransferase antikoerper, BA4351 antikoerper, PSPTO4164 antikoerper, PLXN2 antikoerper, AI265390 antikoerper, Sf antikoerper, spf antikoerper, si:dkey-19h21.3 antikoerper, ornithine carbamoyltransferase antikoerper, plexin A2 antikoerper, ornithine carbamoyltransferase ArgF antikoerper, ornithine transcarbamylase antikoerper, OTC antikoerper, Plxna2 antikoerper, Otc antikoerper, argF antikoerper, argF-2 antikoerper, atpD-2 antikoerper, CNC04300 antikoerper, PLXNA2 antikoerper, otc antikoerper

Hintergrund: OTC is a mitochondrial matrix enzyme. Missense, nonsense, and frameshift mutations in this enzyme lead to ornithine transcarbamylase deficiency, which causes hyperammonemia. Since the gene for this enzyme maps close to that for Duchenne muscular dystrophy, it may play a role in that disease also.

Molekulargewicht: 39 kDa (MW of target protein)