ACADVL Antikörper (AA 538-576)

Produktnummer ABIN5647680

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch ACADVL in WB, IF, IP, IHC (p) und FACS. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für ACADVL Antikörper (AA 538-576) (ABIN5647680)

Target: ACADVL (Acyl-CoA Dehydrogenase, Very Long Chain (ACADVL))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACADVL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunofluorescence (IF), Immunoprecipitation (IP), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Produktdetails anti-ACADVL Antikörper

Bindungsspezifität: AA 538-576

Verwendungszweck: ACADVL Antibody / VLCAD

Sequenz: RALEQFATVV EAKLIKHKKG IVNEQFLLQR LADGAIDLY

Aufreinigung: Antigen affinity

Immunogen: Amino acids 538-576 (RALEQFATVVEAKLIKHKKGIVNEQFLLQRLADGAIDLY) from the human protein were used as the immunogen for the ACADVL antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Differences in protocols and secondary/substrate sensitivity may require the ACADVL antibody to be titrated for optimal performance.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the ACADVL antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu ACADVL

Target: ACADVL (Acyl-CoA Dehydrogenase, Very Long Chain (ACADVL))

Andere Bezeichnung: ACADVL

Hintergrund: Very long-chain specific acyl-CoA dehydrogenase, mitochondrial (VLCAD) is an enzyme that in humans is encoded by the ACADVL gene. The protein encoded by this gene is targeted to the inner mitochondrial membrane, where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenaseis specific to long-chain and very-long-chain fatty acids. A deficiency in this gene product reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy. Alternative splicing results in multiple transcript variants encoding different isoforms.

UniProt: P49748

Pathways: ER-Nucleus Signaling, Monocarboxylic Acid Catabolic Process