ACADVL Antikörper (N-Term)

Produktnummer ABIN630886

Produktdetails anti-ACADVL Antikörper

Target: ACADVL (Acyl-CoA Dehydrogenase, Very Long Chain (ACADVL))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACADVL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ACADVL antibody was raised against the N terminal of ACADVL

Aufreinigung: Affinity purified

Immunogen: ACADVL antibody was raised using the N terminal of ACADVL corresponding to a region with amino acids RPYAGGAAQESKSFAVGMFKGQLTTDQVFPYPSVLNEEQTQFLKELVEPV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACADVL Blocking Peptide, catalog no. 33R-8111, is also available for use as a blocking control in assays to test for specificity of this ACADVL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACADVL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACADVL

Target: ACADVL (Acyl-CoA Dehydrogenase, Very Long Chain (ACADVL))

Andere Bezeichnung: ACADVL (ACADVL Produkte)

Synonyme: ACAD6 antikoerper, LCACD antikoerper, VLCAD antikoerper, vlcad antikoerper, fb52d04 antikoerper, wu:fb52d04 antikoerper, wu:fc75e01 antikoerper, zgc:64067 antikoerper, acyl-CoA dehydrogenase very long chain antikoerper, acyl-Coenzyme A dehydrogenase, very long chain antikoerper, acyl-CoA dehydrogenase, very long chain antikoerper, ACADVL antikoerper, Acadvl antikoerper, acadvl antikoerper

Hintergrund: ACADVL is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in ACADVL protein reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy.

Molekulargewicht: 64 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling, Monocarboxylic Acid Catabolic Process