HCN2 Antikörper (AA 682-714)

Produktnummer ABIN5647571

Der Kaninchen Polyklonal anti-HCN2 Antikörper (ABIN5647571) detektiert spezifisch HCN2 in WB und IHC (p). Dieser Antikörper reagiert spezifisch mit Proben aus Ratte und Maus.

Kurzübersicht für HCN2 Antikörper (AA 682-714) (ABIN5647571)

Target: HCN2 (Hyperpolarization Activated Cyclic Nucleotide-Gated Potassium Channel 2 (HCN2))

Reaktivität: Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HCN2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-HCN2 Antikörper

Bindungsspezifität: AA 682-714

Kreuzreaktivität (Details): Expected species reactivity: Human

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 682-714 (VFNNQENAIIQEIVKYDREMVQQAELGQRVGLF) from the human protein were used as the immunogen for the HCN2 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the HCN2 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the HCN2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu HCN2

Target: HCN2 (Hyperpolarization Activated Cyclic Nucleotide-Gated Potassium Channel 2 (HCN2))

Andere Bezeichnung: HCN2

Hintergrund: Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated ion channel 2 is a protein that in humans is encoded by the HCN2 gene. The HCN2 gene is localized on human chromosome 19p13.3 and contains eight exons spanning approximately 27 kb. Hyperpolarization-activated cation channels of the HCN gene family, such as HCN2, contribute to spontaneous rhythmic activity in both heart and brain.

UniProt: Q9UL51