DVL2 Antikörper (AA 35-64)

Produktnummer ABIN5647553

Produktdetails anti-DVL2 Antikörper

Target: DVL2 (Dishevelled, Dsh Homolog 2 (Drosophila) (DVL2))

Bindungsspezifität: AA 35-64

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DVL2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 35-64 (AERITLGDFKSVLQRPAGAKYFFKSMDQDF) from the human protein were used as the immunogen for the Dishevelled 2 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Dishevelled 2 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the Dishevelled 2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu DVL2

Target: DVL2 (Dishevelled, Dsh Homolog 2 (Drosophila) (DVL2))

Andere Bezeichnung: Dishevelled 2 / DVL2 (DVL2 Produkte)

Synonyme: Xdsh antikoerper, dishevelled antikoerper, dsh antikoerper, dvl antikoerper, Dvl-2 antikoerper, xdsh antikoerper, wu:fc05d12 antikoerper, wu:fo71e09 antikoerper, wu:fp54a02 antikoerper, zgc:55372 antikoerper, dishevelled segment polarity protein 2 antikoerper, dishevelled segment polarity protein 2 L homeolog antikoerper, DVL2 antikoerper, dvl2 antikoerper, Dvl2 antikoerper, dvl2.L antikoerper

Hintergrund: Segment polarity protein dishevelled homolog DVL-2 is a protein that in humans is encoded by the DVL2 gene. This gene encodes a member of the dishevelled (dsh) protein family. The vertebrate dsh proteins have approximately 40 % amino acid sequence similarity with Drosophila dsh. This gene encodes a 90-kD protein that undergoes posttranslational phosphorylation to form a 95-kD cytoplasmic protein, which may play a role in the signal transduction pathway mediated by multiple Wnt proteins. The mechanisms of dishevelled function in Wnt signaling are likely to be conserved among metazoans.

UniProt: O14641

Pathways: Tube Formation