SIX3 Antikörper (AA 1-32)

Produktnummer ABIN5647434

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch SIX3 in WB. Es zeigt Reaktivität gegenüber Proben von Maus und Ratte.

Kurzübersicht für SIX3 Antikörper (AA 1-32) (ABIN5647434)

Target: SIX3 (Sine Oculis-Related Homeobox 3 (SIX3))

Reaktivität: Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SIX3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SIX3 Antikörper

Bindungsspezifität: AA 1-32

Verwendungszweck: Six3 Antibody (N-Terminal Region)

Sequenz: MVFRSPLDLY SSHFLLPNFA DSHHRSILLA SS

Kreuzreaktivität (Details): Expected species reactivity: Human

Aufreinigung: Antigen affinity

Immunogen: Amino acids 1-32 (MVFRSPLDLYSSHFLLPNFADSHHRSILLASS) were used as the immunogen for the Six3 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Six3 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the Six3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu SIX3

Target: SIX3 (Sine Oculis-Related Homeobox 3 (SIX3))

Andere Bezeichnung: Six3

Hintergrund: Homeobox protein SIX3 is a protein that in humans is encoded by the SIX3 gene. This gene encodes a member of the sine oculishomeobox transcription factor family. The encoded protein plays a role in eye development. Mutations in SIX3 are the cause of a severe brain malformation, called holoprosencephaly type 2 (HPE2). In HPE2, the brain fails to separate into two hemispheres during early embryonic development, leading to eye and brain malformations, which result in serious facial abnormalities. A mutant zebrafish knockout model has been developed, in which the anterior part of the head was missing due to the atypical increase of Wnt1 activity. When injected with SIX3, these zebrafish embryos were able to successfully develop a normal forebrain. When SIX3 was turned off in mice, resulting in a lack of retina formation due to excessive expression of Wnt8b in the region where the forebrain normally develops. Both of these studies demonstrate the importance of SIX3 activity in brain and eye development.

UniProt: O95343

Pathways: Protein targeting to Nucleus