SIX3 Antikörper (AA 1-32)

Produktnummer ABIN5647434

Produktdetails anti-SIX3 Antikörper

Target: SIX3 (Sine Oculis-Related Homeobox 3 (SIX3))

Bindungsspezifität: AA 1-32

Reaktivität: Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SIX3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Kreuzreaktivität (Details): Expected species reactivity: Human

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 1-32 (MVFRSPLDLYSSHFLLPNFADSHHRSILLASS) were used as the immunogen for the Six3 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Six3 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the Six3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu SIX3

Target: SIX3 (Sine Oculis-Related Homeobox 3 (SIX3))

Andere Bezeichnung: Six3 (SIX3 Produkte)

Synonyme: HPE2 antikoerper, SIX3 antikoerper, cb347 antikoerper, six3.2 antikoerper, six6 antikoerper, E130112M24Rik antikoerper, Six3a antikoerper, Six3alpha antikoerper, Six3b antikoerper, Six3beta antikoerper, six3 antikoerper, six3.1 antikoerper, wu:fc10a08 antikoerper, SIX homeobox 3 antikoerper, SIX homeobox 3b antikoerper, sine oculis-related homeobox 3 antikoerper, SIX homeobox 3a antikoerper, sine oculis homeobox homolog 3 antikoerper, SIX3 antikoerper, six3b antikoerper, Six3 antikoerper, six3a antikoerper, six3 antikoerper

Hintergrund: Homeobox protein SIX3 is a protein that in humans is encoded by the SIX3 gene. This gene encodes a member of the sine oculishomeobox transcription factor family. The encoded protein plays a role in eye development. Mutations in SIX3 are the cause of a severe brain malformation, called holoprosencephaly type 2 (HPE2). In HPE2, the brain fails to separate into two hemispheres during early embryonic development, leading to eye and brain malformations, which result in serious facial abnormalities. A mutant zebrafish knockout model has been developed, in which the anterior part of the head was missing due to the atypical increase of Wnt1 activity. When injected with SIX3, these zebrafish embryos were able to successfully develop a normal forebrain. When SIX3 was turned off in mice, resulting in a lack of retina formation due to excessive expression of Wnt8b in the region where the forebrain normally develops. Both of these studies demonstrate the importance of SIX3 activity in brain and eye development.

UniProt: O95343

Pathways: Protein targeting to Nucleus