Endoglin Antikörper (AA 258-297)

Produktnummer ABIN5647366

Der Kaninchen Polyklonal anti-Endoglin Antikörper wird verwendet zum Nachweis von Endoglin in Proben von Human. Er wurde validiert für WB und FACS.

Kurzübersicht für Endoglin Antikörper (AA 258-297) (ABIN5647366)

Target: Endoglin (ENG)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Endoglin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Flow Cytometry (FACS)

Produktdetails anti-Endoglin Antikörper

Bindungsspezifität: AA 258-297

Verwendungszweck: Endoglin Antibody / CD105

Sequenz: YVSWLIDANH NMQIWTTGEY SFKIFPEKNI RGFKLPDTPQ

Aufreinigung: Antigen affinity

Immunogen: Amino acids 258-297 (YVSWLIDANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQ) from the human protein were used as the immunogen for the Endoglin antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Endoglin antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the Endoglin antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu Endoglin

Target: Endoglin (ENG)

Andere Bezeichnung: Endoglin

Hintergrund: Endoglin (Osler-Rendu-Weber syndrome 1), also called CD105, is a type I membrane glycoprotein located on cell surfaces and is a part of the TGF beta receptor complex. Its gene is mapped to human chromosome 8. The protein consists of a homodimer of 180 kDA with disulfide links. It has been found on endothelial cells, activated macrophages, fibroblasts and smooth muscle cells. Endoglin has a role in the development of the cardiovascular system and in vascular remodeling and has been found to be elevated in pregnant women who subsequently develop preeclampsia.

UniProt: P17813