HTRA3 Antikörper (AA 330-362)

Produktnummer ABIN5647345

Produktdetails anti-HTRA3 Antikörper

Target: HTRA3 (HtrA Serine Peptidase 3 (HTRA3))

Bindungsspezifität: AA 330-362

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HTRA3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 330-362 (FAIPSDRITRFLTEFQDKQIKDWKKRFIGIRMR) from the human protein were used as the immunogen for the HtrA3 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the HtrA3 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the HtrA3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu HTRA3

Target: HTRA3 (HtrA Serine Peptidase 3 (HTRA3))

Andere Bezeichnung: HtrA3 (HTRA3 Produkte)

Synonyme: HTRA3 antikoerper, Prsp antikoerper, Tasp antikoerper, 2210021K23Rik antikoerper, 9530081K03Rik antikoerper, RGD1308120 antikoerper, Trypsin-like serine protease antikoerper, HtrA serine peptidase 3 antikoerper, htrA3 antikoerper, HTRA3 antikoerper, Htra3 antikoerper

Hintergrund: Human HtrA3 protease, which induces mitochondria-mediated apoptosis, can be a tumor suppressor and a potential therapeutic target in the treatment of cancer. It may also have a role in ovarian development, granulosa cell differentiation and luteinization. The long isoform, HTRA3L, contains 453 amino acids and has a predicted molecular mass of 49 kD. It contains an N-terminal signal peptide, followed by an insulin/IGF (see 147440)-binding domain, a Kazal-type S protease inhibitor domain, a trypsin protease domain, and a PDZ domain. The short isoform, HTRA3S, contains 357 amino acids and has a predicted molecular mass of 38 kD.

UniProt: P83110