HTRA3 Antikörper (AA 330-362)

Produktnummer ABIN5647345

Der Kaninchen Polyklonal Anti-HTRA3-Antikörper wurde für WB validiert. Er ist geeignet, HTRA3 in Proben von Human zu detektieren.

Kurzübersicht für HTRA3 Antikörper (AA 330-362) (ABIN5647345)

Target: HTRA3 (HtrA Serine Peptidase 3 (HTRA3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HTRA3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HTRA3 Antikörper

Bindungsspezifität: AA 330-362

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 330-362 (FAIPSDRITRFLTEFQDKQIKDWKKRFIGIRMR) from the human protein were used as the immunogen for the HtrA3 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the HtrA3 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the HtrA3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu HTRA3

Target: HTRA3 (HtrA Serine Peptidase 3 (HTRA3))

Andere Bezeichnung: HtrA3

Hintergrund: Human HtrA3 protease, which induces mitochondria-mediated apoptosis, can be a tumor suppressor and a potential therapeutic target in the treatment of cancer. It may also have a role in ovarian development, granulosa cell differentiation and luteinization. The long isoform, HTRA3L, contains 453 amino acids and has a predicted molecular mass of 49 kD. It contains an N-terminal signal peptide, followed by an insulin/IGF (see 147440)-binding domain, a Kazal-type S protease inhibitor domain, a trypsin protease domain, and a PDZ domain. The short isoform, HTRA3S, contains 357 amino acids and has a predicted molecular mass of 38 kD.

UniProt: P83110