SCTR Antikörper (AA 398-440)

Produktnummer ABIN5647267

Der Kaninchen Polyklonal Anti-SCTR-Antikörper wurde für WB validiert. Er ist geeignet, SCTR in Proben von Human und Ratte zu detektieren.

Kurzübersicht für SCTR Antikörper (AA 398-440) (ABIN5647267)

Target: SCTR (Secretin Receptor (SCTR))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SCTR Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SCTR Antikörper

Bindungsspezifität: AA 398-440

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 398-440 (EVQKKWQQWHLREFPLHPVASFSNSTKASHLEQSQGTCRTSII) from the human protein were used as the immunogen for the SCTR antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Western blot: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the SCTR antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu SCTR

Target: SCTR (Secretin Receptor (SCTR))

Andere Bezeichnung: SCTR

Hintergrund: Human secretin receptor (gene name SCTR) is a G protein-coupled receptor and belongs to the glucagon-VIP-secretin receptor family. It binds secretin which is the most potent regulator of pancreatic bicarbonate, electrolyte and volume secretion. Secretin and its receptor are suggested to be involved in pancreatic cancer and autism. The SCTR gene is mapped to chromosome 2q14.1 by fluorescence in situ hybridization.

UniProt: P47872