Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

RPS6 Antikörper (AA 13-52)

Der Kaninchen Polyklonal anti-RPS6 Antikörper (ABIN5647262) detektiert spezifisch RPS6 in WB und IHC (p). Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.
Produktnummer ABIN5647262
644,88 €
Zzgl. Versandkosten 20,00 € und MwSt
100 μg
Lieferung nach: Deutschland
Lieferung in 6 bis 9 Werktagen

Kurzübersicht für RPS6 Antikörper (AA 13-52) (ABIN5647262)

Target

Alle RPS6 Antikörper anzeigen
RPS6 (Ribosomal Protein S6 (RPS6))

Reaktivität

  • 144
  • 132
  • 120
  • 12
  • 12
  • 11
  • 10
  • 10
  • 8
  • 8
  • 7
  • 7
  • 5
  • 5
  • 5
  • 4
  • 2
  • 2
  • 2
  • 1
Human, Maus, Ratte

Wirt

  • 161
  • 12
  • 2
  • 2
Kaninchen

Klonalität

  • 143
  • 34
Polyklonal

Konjugat

  • 83
  • 11
  • 8
  • 6
  • 5
  • 5
  • 4
  • 4
  • 4
  • 4
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 2
  • 2
Dieser RPS6 Antikörper ist unkonjugiert

Applikation

  • 153
  • 58
  • 57
  • 45
  • 40
  • 40
  • 27
  • 27
  • 21
  • 18
  • 11
  • 3
  • 2
  • 1
  • 1
  • 1
  • 1
Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
  • Bindungsspezifität

    • 47
    • 29
    • 27
    • 25
    • 15
    • 14
    • 11
    • 9
    • 9
    • 5
    • 5
    • 5
    • 4
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 13-52

    Aufreinigung

    Antigen affinity purified

    Immunogen

    Amino acids 13-52 (QKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRI) from the human protein were used as the immunogen for the RPS6 antibody.

    Isotyp

    IgG
  • Applikationshinweise

    Optimal dilution of the RPS6 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

    Beschränkungen

    Nur für Forschungszwecke einsetzbar
  • Buffer

    0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

    Lagerung

    -20 °C

    Informationen zur Lagerung

    After reconstitution, the RPS6 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Target

    RPS6 (Ribosomal Protein S6 (RPS6))

    Andere Bezeichnung

    RPS6

    Hintergrund

    Ribosomal protein S6 (rpS6) is a component of the 40S ribosomal subunit and is therefore thought to be involved in regulating translation. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a cytoplasmic ribosomal protein that is a component of the 40S subunit. The protein belongs to the S6E family of ribosomal proteins. It is the major substrate of protein kinases in the ribosome, with subsets of five C-terminal serine residues phosphorylated by different protein kinases. Phosphorylation is induced by a wide range of stimuli, including growth factors, tumor-promoting agents, and mitogens. Dephosphorylation occurs at growth arrest. The protein may contribute to the control of cell growth and proliferation through the selective translation of particular classes of mRNA. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. While the true function of rpS6 is currently under investigation, studies have shown that it is involved in the regulation of cell size, cell proliferation, and glucose homeostasis.

    UniProt

    P62753

    Pathways

    Carbohydrate Homeostasis, Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly
Sie sind hier:
Chat with us!