alpha Defensin 1 Antikörper (AA 65-94)

Produktnummer ABIN5647108

Der Kaninchen Polyklonal anti-alpha Defensin 1 Antikörper wird verwendet zum Nachweis von alpha Defensin 1 in Proben von Human und Ratte. Er wurde validiert für WB.

Kurzübersicht für alpha Defensin 1 Antikörper (AA 65-94) (ABIN5647108)

Target: alpha Defensin 1 (DEFA1) (Defensin, alpha 1 (DEFA1))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser alpha Defensin 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-alpha Defensin 1 Antikörper

Bindungsspezifität: AA 65-94

Verwendungszweck: Alpha Defensin 1 Antibody / DEFA1

Sequenz: ACYCRIPACI AGERRYGTCI YQGRLWAFCC

Aufreinigung: Antigen affinity

Immunogen: Amino acids 65-94 (ACYCRIPACIAGERRYGTCIYQGRLWAFCC) from the human protein were used as the immunogen for the Alpha Defensin 1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Alpha Defensin 1 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the Alpha Defensin 1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu alpha Defensin 1

Target: alpha Defensin 1 (DEFA1) (Defensin, alpha 1 (DEFA1))

Andere Bezeichnung: Alpha Defensin 1

Hintergrund: Defensin, alpha 1, also known as human alpha defensin 1, human neutrophil peptide 1 (HNP-1) or neutrophil defensin 1 is a human protein that is encoded by the DEFA1 gene. Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. The protein encoded by this gene, defensin, alpha 1, is found in the microbicidal granules of neutrophils and likely plays a role in phagocyte-mediated host defense. Several alpha defensin genes are clustered on chromosome 8. This gene differs from defensin, alpha 3 by only one amino acid. This gene and the gene encoding defensin, alpha 3 are both subject to copy number variation.

UniProt: P59665

Pathways: Cellular Response to Molecule of Bacterial Origin